General Information

  • ID:  hor002391
  • Uniprot ID:  P12872
  • Protein name:  Motilin
  • Gene name:  MLN
  • Organism:  Homo sapiens (Human)
  • Family:  Motilin family
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with MLN include Gastroparesis and Duodenogastric Reflux.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005515 protein binding; GO:0031788 motilin receptor binding
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  FVPIFTYGELQRMQEKERNKGQ
  • Length:  22
  • Propeptide:  MVSRKAVAALLVVHVAAMLASQTEAFVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAK
  • Signal peptide:  MVSRKAVAALLVVHVAAMLASQTEA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  MLNR
  • Target Unid:  O43193
  • IC50: NA
  • EC50: EC50=8.9x10-11nM for GPR38 agonist activity ( PubMed ID: 22286034 )
  • ED50: NA
  • kd: NA
  • Half life: 3.3±1.0 minutes; /198 seconds ( PubMed ID: 22286034 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  1lbj(PDB_ID)/AF-Q969E3-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    1lbj.pdbhor002391_AF2.pdbhor002391_ESM.pdb

Physical Information

Mass: 307382 Formula: C120H188N34O35S
Absent amino acids: ACDHSW Common amino acids: EQ
pI: 9.25 Basic residues: 4
Polar residues: 5 Hydrophobic residues: 5
Hydrophobicity: -116.82 Boman Index: -6327
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 48.64
Instability Index: 4367.27 Extinction Coefficient cystines: 1490
Absorbance 280nm: 70.95

Literature