General Information

  • ID:  hor002386
  • Uniprot ID:  Q9XSE2
  • Protein name:  Motilin-associated peptide
  • Gene name:  MLN
  • Organism:  Felis catus (Cat) (Felis silvestris catus)
  • Family:  Motilin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Felis (genus), Felinae (subfamily), Felidae (family), Feliformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031788 motilin receptor binding
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SLIVQQRSEEVGPLDPVEPPEEEENEVIKLTAPVAIGTRMNSRQLEKYRAALEGLLSEVLLPARNDK
  • Length:  67(50-116)
  • Propeptide:  MVSRKAVAVLLMVHVAVMLASQTEAFVPIFTHSELQRIREKERNKGQKKSLIVQQRSEEVGPLDPVEPPEEEENEVIKLTAPVAIGTRMNSRQLEKYRAALEGLLSEVLLPARNDK
  • Signal peptide:  MVSRKAVAVLLMVHVAVMLASQTEA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9XSE2-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002386_AF2.pdbhor002386_ESM.pdb

Physical Information

Mass: 864488 Formula: C325H541N91O107S
Absent amino acids: CFHW Common amino acids: E
pI: 4.3 Basic residues: 8
Polar residues: 13 Hydrophobic residues: 23
Hydrophobicity: -50.15 Boman Index: -14152
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 103.28
Instability Index: 6454.18 Extinction Coefficient cystines: 1490
Absorbance 280nm: 22.58

Literature

  • PubMed ID:  NA
  • Title:  NA