General Information

  • ID:  hor002381
  • Uniprot ID:  O46617
  • Protein name:  Promotilin
  • Gene name:  MLN
  • Organism:  Equus caballus (Horse)
  • Family:  Motilin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Equus (genus), Equidae (family), Perissodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031788 motilin receptor binding
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  FVPIFTYSELQRMQEKERNRGQKKSLGLQQRSEEVGSLDPTEAAEEEGKEVIKLTAPVEIGMRMNSRQLEKYRAALEGLLSEVLLSTQNAAK
  • Length:  92
  • Propeptide:  FVPIFTYSELQRMQEKERNRGQKKSLGLQQRSEEVGSLDPTEAAEEEGKEVIKLTAPVEIGMRMNSRQLEKYRAALEGLLSEVLLSTQNAAK
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O46617-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-O46617-F1.pdbhor002381_AF2.pdbhor002381_ESM.pdb

Physical Information

Mass: 1203315 Formula: C450H746N130O146S3
Absent amino acids: CHW Common amino acids: E
pI: 5.25 Basic residues: 14
Polar residues: 22 Hydrophobic residues: 28
Hydrophobicity: -69.89 Boman Index: -22001
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 82.72
Instability Index: 4983.91 Extinction Coefficient cystines: 2980
Absorbance 280nm: 32.75

Literature

  • PubMed ID:  NA
  • Title:  NA