HORDB

ID: hor002377
Uniprot ID: O62820
Protein name: Motilin-associated peptide
Gene name: MLN
Organism: Bos taurus (Bovine)
Family: Motilin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0031788 motilin receptor binding
GO BP: GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region

Sequence: SLSVQQRSEEVGPVDPTEPWEEKQEVIKLTAPVEIGMRMNSRQLEKYQATLEGLLREVLPPSRNAQ
Length: 66
Propeptide: MLSRKATAVLLAVHAAAMLASQTEAFVPIFTYGEVRRMQEKERYKGQKKSLSVQQRSEEVGPVDPTEPWEEKQEVIKLTAPVEIGMRMNSRQLEKYQATLEGLLREVLPPSRNAQ
Signal peptide: MLSRKATAVLLAVHAAAMLASQTEA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
Mechanism: NA
Cross BBB: NA
Target: MLNR
Target Unid: F1MPN9
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002377_AF2.pdb

hor002377_ESM.pdb

Mass:	867706	Formula:	C326H535N93O106S2
Absent amino acids:	CFH	Common amino acids:	E
pI:	4.53	Basic residues:	8
Polar residues:	14	Hydrophobic residues:	19
Hydrophobicity:	-75.45	Boman Index:	-15564
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	84.09
Instability Index:	7068.18	Extinction Coefficient cystines:	6990
Absorbance 280nm:	107.54