General Information

  • ID:  hor002374
  • Uniprot ID:  Q8JFY4
  • Protein name:  Ghrelin
  • Gene name:  ghrl
  • Organism:  Anguilla japonica (Japanese eel)
  • Family:  Motilin family
  • Source:  Animal
  • Expression:  Highest levels in stomach and anterior intestine. Lower levels in posterior intestine, kidney and brain. Low levels in heart, head kidney and middle intestine.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Anguilla (genus), Anguillidae (family), Anguilliformes (order), Elopomorpha, Elopocephala, Elopocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity; GO:0016608 growth hormone-releasing hormone activity
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  GSSFLSPSQRPQGKDKKPPRV
  • Length:  21(27-47)
  • Propeptide:  MRQMKRTAYIILLVCVLALWMDSVQAGSSFLSPSQRPQGKDKKPPRVGRRDSDGILDLFMRPPLQDEDIRHITFNTPFEIGITMTEELFQQYGEVMQKIMQDLLMDTPAKE
  • Signal peptide:  MRQMKRTAYIILLVCVLALWMDSVQA
  • Modification:  T21 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P83859-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P83859-F1.pdbhor002374_AF2.pdbhor002374_ESM.pdb

Physical Information

Mass: 265350 Formula: C100H166N32O30
Absent amino acids: ACEHIMNTWY Common amino acids: PS
pI: 11.75 Basic residues: 5
Polar residues: 6 Hydrophobic residues: 3
Hydrophobicity: -146.67 Boman Index: -6607
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 32.38
Instability Index: 7020.95 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  12630926
  • Title:  Amidated fish ghrelin: purification, cDNA cloning in the Japanese eel and its biological activity.