General Information

  • ID:  hor002367
  • Uniprot ID:  Q25413
  • Protein name:  GLQMLRL-amide
  • Gene name:  NA
  • Organism:  Lymnaea stagnalis (Great pond snail) (Helix stagnalis)
  • Family:  Myomodulin family
  • Source:  Animal
  • Expression:  Expressed in all ganglia of the CNS, but only in a subset of neurons.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lymnaea (genus), Lymnaeidae (family), Lymnaeoidea (superfamily), Hygrophila, Panpulmonata, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GLQMLRL
  • Length:  7(55-61)
  • Propeptide:  MQGAFLITFIVLTMTLVSIGNTEESGGQTSSNDKTEPAQSRTKRRSREMGRVVRGLQMLRLGKRDSVSTSEDPGDIDDILSLLQAYQEQNPEFAFNEEERELSGDELEVPEHHRFRRSTENSGVAPQEVQQSQSFKDSGEHELKLEEAEPYLYFPDGDFYYGDVDELLEGDNEDGSADKRQIPMLRLGKRSMSMLRLGKREEDDADFDEEKRSLSMLRLGKREDDNFEDSFDEENDKRSLSMLRLGKRPMSMLRL
  • Signal peptide:  MQGAFLITFIVLTMTLVSIGNT
  • Modification:  T7 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Enhance the relaxation rate of electrically-induced contraction of the penis retractor muscle.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q99P85-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q99P85-F1.pdbhor002367_AF2.pdbhor002367_ESM.pdb

Physical Information

Mass: 93727 Formula: C36H67N11O9S
Absent amino acids: ACDEFHIKNPSTVWY Common amino acids: L
pI: 10.55 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 3
Hydrophobicity: 70 Boman Index: -241
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 167.14
Instability Index: 8265.71 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  8522970
  • Title:  Various Isoforms of Myomodulin Identified From the Male Copulatory Organ of Lymnaea Show Overlapping Yet Distinct Modulatory Effects on the Penis Muscle