General Information

  • ID:  hor002364
  • Uniprot ID:  Q2VF17
  • Protein name:  MMG2-DPf
  • Gene name:  MMG2
  • Organism:  Aplysia californica (California sea hare)
  • Family:  Myomodulin family
  • Source:  Animal
  • Expression:  Expressed in the pedal-buccal projection neurons in the pedal ganglion.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AVPRPRI
  • Length:  7(220-226)
  • Propeptide:  MWKILETCSCFLVVAVLSGLGKAQPESFSGSAVTDDSTSGANKRGWSMLRLGRGLQMLRLGKRGGSLDALRSGHQVPMLRAGRGSPDTSGRLDANELYAVLSAILDEPRDQSRRQPPLPRYGRDNNGVARDLLDALASDGESSSNFDLLSSLNNGPSYFRPAPRGGRYKRSLPDAGPADYPSLEDYLVQSRQFARPYSSRAVALPRIGRFSGSPRLQAKAVPRPRIGRQESQMREAKSAE
  • Signal peptide:  MWKILETCSCFLVVAVLSGLGKA
  • Modification:  T7 Isoleucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Bias egestive feeding programs toward ingestive ones, and modulate accessory radula closer (ARC) muscle contractions.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q2VF17-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002364_AF2.pdbhor002364_ESM.pdb

Physical Information

Mass: 91519 Formula: C36H65N13O8
Absent amino acids: CDEFGHKLMNQSTWY Common amino acids: PR
pI: 12.5 Basic residues: 2
Polar residues: 0 Hydrophobic residues: 3
Hydrophobicity: -24.29 Boman Index: -1907
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 111.43
Instability Index: 4205.71 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  16237168
  • Title:  Identification of a New Neuropeptide Precursor Reveals a Novel Source of Extrinsic Modulation in the Feeding System of Aplysia