General Information

  • ID:  hor002341
  • Uniprot ID:  P01361
  • Protein name:  Atrial gland peptide B
  • Gene name:  NA
  • Organism:  Aplysia californica (California sea hare)
  • Family:  Molluscan ELH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AVKSSSYEKYPFDLSKEDGAQPYFMTPRLRFYPI
  • Length:  34(36-69)
  • Propeptide:  MKANTMFIILCLTLSTLCVSSQFTSVLGKIFVTNRAVKSSSYEKYPFDLSKEDGAQPYFMTPRLRFYPIGKRAAGGMEQSEGQNPETKSHSWRERSVLTPSLLSLGESLESGISKRISINQD
  • Signal peptide:  MKANTMFIILCLTLSTLCVSS
  • Modification:  T34 Isoleucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Control the physiological processes of egg-laying
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01361-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002341_AF2.pdbhor002341_ESM.pdb

Physical Information

Mass: 462134 Formula: C188H276N44O53S
Absent amino acids: CHNW Common amino acids: PSY
pI: 8.95 Basic residues: 5
Polar residues: 10 Hydrophobic residues: 9
Hydrophobicity: -70.29 Boman Index: -6517
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 48.82
Instability Index: 5554.41 Extinction Coefficient cystines: 5960
Absorbance 280nm: 180.61

Literature

  • PubMed ID:  6929554
  • Title:  Purification and primary structure of two neuroactive peptides that cause bag cell afterdischarge and egg-laying in Aplysia.