General Information

  • ID:  hor002337
  • Uniprot ID:  P11924
  • Protein name:  Califin-B large subunit
  • Gene name:  NA
  • Organism:  Aplysia californica (California sea hare)
  • Family:  Molluscan ELH family
  • Source:  Animal
  • Expression:  atrial gland
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ISINQDLKAITDMLLTEQIQARQRCLAALRQRLLDL
  • Length:  36(1-36)
  • Propeptide:  ISINQDLKAITDMLLTEQIQARQRCLAALRQRLLDLDSDVSLFNGDLLPNGRCS
  • Signal peptide:  NA
  • Modification:  T36 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Excites LB and LC cells of the abdominal ganglion and cause egg-laying
  • Mechanism:  Califin B probably derives from polyprotein B, which is also the precursor for peptide B.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P11924-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002337_AF2.pdbhor002337_ESM.pdb

Physical Information

Mass: 479046 Formula: C179H315N55O54S2
Absent amino acids: FGHPVWY Common amino acids: L
pI: 8.54 Basic residues: 5
Polar residues: 5 Hydrophobic residues: 16
Hydrophobicity: 2.5 Boman Index: -7117
Half-Life: 20 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 141.11
Instability Index: 4271.94 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  3753705
  • Title:  Isolation and primary structure of the califins, three biologically active egg-laying hormone-like peptides from the atrial gland of Aplysia californica