HORDB

ID: hor002328
Uniprot ID: P01362
Protein name: Egg-laying hormone(30-36)
Gene name: NA
Organism: Aplysia californica (California sea hare)
Family: Molluscan ELH family
Source: animal
Expression: Bag cell neurons.
Disease: NA
Comments: NA
Taxonomy: Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007218 neuropeptide signaling pathway
GO CC: GO:0005576 extracellular region

Sequence: RQRLLEK
Length: 7
Propeptide: MKRPNNRPTNTMSLILCLTLSSLCVSSQSASVHGKNFATNRAVKSSSPFVVLSPDDNVVSMSGENGYRSALREAFDKSSRDYDDNGEDVFSNEKRRLRFHKRRLRFDRRDQDEGNFRRFPTNAVSMSADENSPFDLSNEDGAVYQRDLRAPRLRFYSLRKRAAGGMEQSEGQNPETESHSRRKRSVLTPSLSSLGESLESGISKRISINQDLKAITDMLLTEQIRERQRYLADLRQRLLEKGKRSSGVSLLTSNKDEEQRELLKAISNLLD
Signal peptide: MKRPNNRPTNTMSLILCLTLSSLCVSSQ
Modification: T7 Lysine amide
Glycosylation: NA
Mutagenesis: NA

Function: ELH acts as a neurotransmitter locally, upon neurons of the abdominal ganglion and as a hormone by diffusing into the circulating hemolymph and modulating the activity of other organs. It specifically causes contraction of smooth muscle in the ovotestis and expulsion of the egg string.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002328_AF2.pdb

hor002328_ESM.pdb

Mass:	104933	Formula:	C40H75N15O11
Absent amino acids:	ACDFGHIMNPSTVWY	Common amino acids:	LR
pI:	11.48	Basic residues:	3
Polar residues:	0	Hydrophobic residues:	2
Hydrophobicity:	-175.71	Boman Index:	-3790
Half-Life:	1 hour	Half-Life Yeast:	2 min
Half-Life E.Coli:	2 min	Aliphatic Index	111.43
Instability Index:	3608.57	Extinction Coefficient cystines:	0
Absorbance 280nm:	0