General Information

  • ID:  hor002322
  • Uniprot ID:  P01362
  • Protein name:  Delta-bag cell peptide
  • Gene name:  NA
  • Organism:  Aplysia californica (California sea hare)
  • Family:  Molluscan ELH family
  • Source:  Animal
  • Expression:  Bag cell neurons.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DQDEGNFRRFPTNAVSMSADENSPFDLSNEDGAVYQRDL
  • Length:  39(110-148)
  • Propeptide:  MKRPNNRPTNTMSLILCLTLSSLCVSSQSASVHGKNFATNRAVKSSSPFVVLSPDDNVVSMSGENGYRSALREAFDKSSRDYDDNGEDVFSNEKRRLRFHKRRLRFDRRDQDEGNFRRFPTNAVSMSADENSPFDLSNEDGAVYQRDLRAPRLRFYSLRKRAAGGMEQSEGQNPETESHSRRKRSVLTPSLSSLGESLESGISKRISINQDLKAITDMLLTEQIRERQRYLADLRQRLLEKGKRSSGVSLLTSNK
  • Signal peptide:  MKRPNNRPTNTMSLILCLTLSSLCVSSQ
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  ELH acts as a neurotransmitter locally, upon neurons of the abdominal ganglion and as a hormone by diffusing into the circulating hemolymph and modulating the activity of other organs. It specifically causes contraction of smooth muscle in the ovotestis a
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01362-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002322_AF2.pdbhor002322_ESM.pdb

Physical Information

Mass: 508658 Formula: C185H276N54O70S
Absent amino acids: CHIKW Common amino acids: D
pI: 3.75 Basic residues: 3
Polar residues: 12 Hydrophobic residues: 10
Hydrophobicity: -111.54 Boman Index: -13494
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 42.56
Instability Index: 5347.95 Extinction Coefficient cystines: 1490
Absorbance 280nm: 39.21

Literature

  • PubMed ID:  9520477
  • Title:  Proteolytic Processing of the Aplysia Egg-Laying Hormone Prohormone