General Information

  • ID:  hor002318
  • Uniprot ID:  P01362
  • Protein name:  Alpha-bag cell peptide
  • Gene name:  NA
  • Organism:  Aplysia californica (California sea hare)
  • Family:  Molluscan ELH family
  • Source:  Animal
  • Expression:  Bag cell neurons.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  APRLRFYSL
  • Length:  9(150-158)
  • Propeptide:  MKRPNNRPTNTMSLILCLTLSSLCVSSQSASVHGKNFATNRAVKSSSPFVVLSPDDNVVSMSGENGYRSALREAFDKSSRDYDDNGEDVFSNEKRRLRFHKRRLRFDRRDQDEGNFRRFPTNAVSMSADENSPFDLSNEDGAVYQRDLRAPRLRFYSLRKRAAGGMEQSEGQNPETESHSRRKRSVLTPSLSSLGESLESGISKRISINQDLKAITDMLLTEQIRERQRYLADLRQRLLEKGKRSSGVSLLTSNK
  • Signal peptide:  MKRPNNRPTNTMSLILCLTLSSLCVSSQ
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Decreases the activity of a cluster of neurons in the left upper quadrant of the abdominal ganglion.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 35 minutes; /2100 seconds ( PubMed ID: 1939259 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01362-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002318_AF2.pdbhor002318_ESM.pdb

Physical Information

Mass: 126520 Formula: C53H83N15O12
Absent amino acids: CDEGHIKMNQTVW Common amino acids: LR
pI: 11.15 Basic residues: 2
Polar residues: 2 Hydrophobic residues: 4
Hydrophobicity: -5.56 Boman Index: -1875
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 97.78
Instability Index: 7953.33 Extinction Coefficient cystines: 1490
Absorbance 280nm: 186.25

Literature

  • PubMed ID:  16593372##1939259
  • Title:  Primary Structure and Neuronal Effects of Alpha-Bag Cell Peptide, a Second Candidate Neurotransmitter Encoded by a Single Gene in Bag Cell Neurons of Aplysia