HORDB

ID: hor002313
Uniprot ID: P01362
Protein name: Acidic peptide(7-27)
Gene name: NA
Organism: Aplysia californica (California sea hare)
Family: Molluscan ELH family
Source: animal
Expression: Bag cell neurons.
Disease: NA
Comments: NA
Taxonomy: Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007218 neuropeptide signaling pathway
GO CC: GO:0005576 extracellular region

Sequence: LTSNKDEEQRELLKAISNLLD
Length: 21
Propeptide: MKRPNNRPTNTMSLILCLTLSSLCVSSQSASVHGKNFATNRAVKSSSPFVVLSPDDNVVSMSGENGYRSALREAFDKSSRDYDDNGEDVFSNEKRRLRFHKRRLRFDRRDQDEGNFRRFPTNAVSMSADENSPFDLSNEDGAVYQRDLRAPRLRFYSLRKRAAGGMEQSEGQNPETESHSRRKRSVLTPSLSSLGESLESGISKRISINQDLKAITDMLLTEQIRERQRYLADLRQRLLEKGKRSSGVSLLTSNKDEEQRELLKAISNLLD
Signal peptide: MKRPNNRPTNTMSLILCLTLSSLCVSSQ
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: ELH acts as a neurotransmitter locally, upon neurons of the abdominal ganglion and as a hormone by diffusing into the circulating hemolymph and modulating the activity of other organs. It specifically causes contraction of smooth muscle in the ovotestis and expulsion of the egg string.; Alpha-BCP decreases the activity of a cluster of neurons in the left upper quadrant of the abdominal ganglion.; Beta-BCP specifically excites 2 neurons, L1 and R1, in the abdominal ganglion.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002313_AF2.pdb

hor002313_ESM.pdb

Mass:	278664	Formula:	C103H177N29O38
Absent amino acids:	CFGHMPVWY	Common amino acids:	L
pI:	4.26	Basic residues:	3
Polar residues:	5	Hydrophobic residues:	7
Hydrophobicity:	-82.38	Boman Index:	-6075
Half-Life:	5.5 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	116.19
Instability Index:	4145.24	Extinction Coefficient cystines:	0
Absorbance 280nm:	0