General Information

  • ID:  hor002308
  • Uniprot ID:  P49794
  • Protein name:  Melanin-concentrating hormone
  • Gene name:  mch
  • Organism:  Oreochromis mossambicus (Mozambique tilapia) (Tilapia mossambica)
  • Family:  Melanin-concentrating hormone family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oreochromis (genus), Oreochromini (tribe), Pseudocrenilabrinae (subfamily), African cichlids, Cichlidae (family), Cichliformes (order), Cichlomorphae (superorder), Ovalentaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0030354 melanin-concentrating hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission
  • GO CC:  GO:0045202 synapse

Sequence Information

  • Sequence:  RDTMRCMVGRVYRPCWEV
  • Length:  18(119-136)
  • Propeptide:  MRQSRLSIIFAAALFFKCYALTVALPMAKAEDGSLEKDAFTSLLNDEATENSLGDAELSSMTKSRAPRVIVIAADANLWRDLRVLHNGLPLYKRRVDENNQVVEHKDVGQDLTIPILRRDTMRCMVGRVYRPCWEV
  • Signal peptide:  MRQSRLSIIFAAALFFKCYA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays a role in skin pigmentation by antagonizing the action of melanotropin alpha. Induces melanin concentration within the melanophores. May participate in the control of the hypothalamo-pituitary adrenal gland axis by inhibiting the release of ACTH.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45823
  • Structure ID:  AF-P49794-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002308_AF2.pdbhor002308_ESM.pdb

Physical Information

Mass: 256109 Formula: C95H153N31O25S4
Absent amino acids: AFHIKLNQS Common amino acids: R
pI: 8.8 Basic residues: 4
Polar residues: 5 Hydrophobic residues: 4
Hydrophobicity: -47.22 Boman Index: -5527
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 48.33
Instability Index: 1638.33 Extinction Coefficient cystines: 7115
Absorbance 280nm: 418.53

Literature

  • PubMed ID:  NA
  • Title:  Cloning and sequence analysis of hypothalamus cDNA encoding tilapia melanin-concentrating hormone