HORDB

ID: hor002299
Uniprot ID: Q5XXR2
Protein name: Melanin-concentrating hormone
Gene name: PMCH
Organism: Canis lupus familiaris (Dog) (Canis familiaris)
Family: Melanin-concentrating hormone family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0030354 melanin-concentrating hormone activity; GO:0031777 type 1 melanin-concentrating hormone receptor binding
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission; GO:0007631 feeding behavior
GO CC: GO:0005576 extracellular region; GO:0005634 nucleus; GO:0045202 synapse

Sequence: DFDMLRCMLGRVYRPCWQV
Length: 19
Propeptide: MAKMSLSSYLLILTFSLFSQGILLSASKSIRNLEDDMVFNTFRLGKALQKEDTPQKSVVAPSLEQYKNDDSSFMNDEENKNSKNTGSKHNFLNHGLPLNLAIKPYLALKGSVAFPAENGVQNTESTQEKREIGDEENSAKFPIGRRDFDMLRCMLGRVYRPCWQV
Signal peptide: MAKMSLSSYLLILTFSLFSQG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: MCH may act as a neurotransmitter or neuromodulator in a broad array of neuronal functions directed toward the regulation of goal-directed behavior, such as food intake, and general arousal.
Mechanism: NA
Cross BBB: YES
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002299_AF2.pdb

hor002299_ESM.pdb

Mass:	271012	Formula:	C105H162N30O26S4
Absent amino acids:	AEHIKNST	Common amino acids:	R
pI:	8.22	Basic residues:	3
Polar residues:	4	Hydrophobic residues:	6
Hydrophobicity:	-3.16	Boman Index:	-3645
Half-Life:	1.1 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	71.58
Instability Index:	4108.95	Extinction Coefficient cystines:	7115
Absorbance 280nm:	395.28