General Information

  • ID:  hor002287
  • Uniprot ID:  Q6Y4S4
  • Protein name:  Metastin
  • Gene name:  KISS1
  • Organism:  Mus musculus (Mouse)
  • Family:  KISS1 family
  • Source:  animal
  • Expression:  Weak in all tissue types with highest levels in lung and 15- 17-day embryos. Expressed in areas of the hypothalamus implicated in the neuroendocrine regulation of gonadotropin secretion, including the anteroventral periventricular nucleus, the periventric
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005515 protein binding; GO:0031773 kisspeptin receptor binding
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0008285 negative regulation of cell population proliferation; GO:0033686 positive regulation of luteinizing hormone secretion; GO:0043410 positive regulation of MAPK cascade; GO:0046697 decidualization; GO:0050806 positive regulation of synaptic transmission; GO:0060112 generation of ovulation cycle rhythm; GO:0060124 positive regulation of growth hormone secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0016324 apical plasma membrane; GO:0043025 neuronal cell body

Sequence Information

  • Sequence:  SSPCPPVEGPAGRQRPLCASRSRLIPAPRGAVLVQREKDLSTYNWNSFGLRY
  • Length:  52
  • Propeptide:  MISMASWQLLLLLCVATYGEPLAKVAPLVKPGSTGQQSGPQELVNAWEKESRYAESKPGSAGLRARRSSPCPPVEGPAGRQRPLCASRSRLIPAPRGAVLVQREKDLSTYNWNSFGLRYGRRQAARAARG
  • Signal peptide:  MISMASWQLLLLLCVATYG
  • Modification:  T43 Phosphotyrosine;T52 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Be essential for normal gonadotropin-released hormone physiology and for puberty.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Kiss1r
  • Target Unid:  Q91V45
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  4-18
  • Structure ID:  AF-Q6Y4S4-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002287_AF2.pdbhor002287_ESM.pdb

Physical Information

Mass: 666540 Formula: C252H403N79O72S2
Absent amino acids: HM Common amino acids: PRS
pI: 10.62 Basic residues: 8
Polar residues: 17 Hydrophobic residues: 15
Hydrophobicity: -58.85 Boman Index: -11943
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 69.42
Instability Index: 6319.04 Extinction Coefficient cystines: 8605
Absorbance 280nm: 168.73

Literature

  • PubMed ID:  15217982
  • Title:  A Role for Kisspeptins in the Regulation of Gonadotropin Secretion in the Mouse