HORDB

ID: hor002285
Uniprot ID: Q5PXH1
Protein name: Metastin
Gene name: KISS1
Organism: Macaca mulatta (Rhesus macaque)
Family: KISS1 family
Source: animal
Expression: In the hypothalamus, expression increases with puberty in both male and female monkeys. Robust expression in the region of the arcuate nucleus (ARC).
Disease: NA
Comments: NA
Taxonomy: Macaca (genus), Cercopithecinae (subfamily), Cercopithecidae (family), Cercopithecoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0031773 kisspeptin receptor binding
GO BP: GO:0007186 G protein-coupled receptor signaling pathway; GO:0007204 positive regulation of cytosolic calcium ion concentration
GO CC: GO:0005576 extracellular region

Sequence: GASLSSPAESSGSPQRRGLSAPSSRQIPAPQGAVLVQREKDLPNYNW
Length: 47
Propeptide: SVENSRPTGQQLESLDLSAPWEQSLPCTERKPSATARLSRRGASLSSPAESSGSPQRRGLSAPSSRQIPAPQGAVLVQREKDLPNYNW
Signal peptide: NA
Modification: T45 Phosphotyrosine
Glycosylation: NA
Mutagenesis: NA

Function: Metastasis suppressor protein. May regulate events downstream of cell-matrix adhesion, perhaps involving cytoskeletal reorganization. Generates a C-terminally amidated peptide, metastin which functions as the endogenous ligand of the G-protein coupled receptor GPR54. The receptor is essential for normal gonadotropin-released hormone physiology and for puberty. The hypothalamic KiSS1/GPR54 system is a pivotal factor in central regulation of the gonadotropic axis at puberty and in adulthood.
Mechanism: NA
Cross BBB: NA
Target: KISS1R
Target Unid: F6YBI8
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002285_AF2.pdb

hor002285_ESM.pdb

Mass:	576909	Formula:	C212H341N67O70
Absent amino acids:	CFHMT	Common amino acids:	S
pI:	10.43	Basic residues:	5
Polar residues:	16	Hydrophobic residues:	13
Hydrophobicity:	-78.51	Boman Index:	-10593
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	64.47
Instability Index:	8980.43	Extinction Coefficient cystines:	6990
Absorbance 280nm:	151.96