General Information

  • ID:  hor002285
  • Uniprot ID:  Q5PXH1
  • Protein name:  Metastin
  • Gene name:  KISS1
  • Organism:  Macaca mulatta (Rhesus macaque)
  • Family:  KISS1 family
  • Source:  Animal
  • Expression:  In the hypothalamus, expression increases with puberty in both male and female monkeys. Robust expression in the region of the arcuate nucleus (ARC).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Macaca (genus), Cercopithecinae (subfamily), Cercopithecidae (family), Cercopithecoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0031773 kisspeptin receptor binding
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0007204 positive regulation of cytosolic calcium ion concentration
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GASLSSPAESSGSPQRRGLSAPSSRQIPAPQGAVLVQREKDLPNYNW
  • Length:  47(42-88)
  • Propeptide:  SVENSRPTGQQLESLDLSAPWEQSLPCTERKPSATARLSRRGASLSSPAESSGSPQRRGLSAPSSRQIPAPQGAVLVQREKDLPNYNW
  • Signal peptide:  NA
  • Modification:  T45 Phosphotyrosine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Metastasis suppressor protein. May regulate events downstream of cell-matrix adhesion, perhaps involving cytoskeletal reorganization. Generates a C-terminally amidated peptide, metastin which functions as the endogenous ligand of the G-protein coupled rec
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  KISS1R
  • Target Unid:  F6YBI8
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q5PXH1-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002285_AF2.pdbhor002285_ESM.pdb

Physical Information

Mass: 576909 Formula: C212H341N67O70
Absent amino acids: CFHMT Common amino acids: S
pI: 10.43 Basic residues: 5
Polar residues: 16 Hydrophobic residues: 13
Hydrophobicity: -78.51 Boman Index: -10593
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 64.47
Instability Index: 8980.43 Extinction Coefficient cystines: 6990
Absorbance 280nm: 151.96

Literature

  • PubMed ID:  NA
  • Title:  NA