General Information

  • ID:  hor002282
  • Uniprot ID:  Q15726
  • Protein name:  Metastin
  • Gene name:  KISS1
  • Organism:  Homo sapiens (Human)
  • Family:  KISS1 family
  • Source:  Human
  • Expression:  Down-regulated during the progression of melanoma in vivo. Diminishes MMP9 expression by effecting reduced NF-kappa-B binding to the promoter. |Very high expression in placenta, with the next highest level in testis and moderate levels in pancreas, liver,
  • Disease:  Diseases associated with KISS1 include Hypogonadotropic Hypogonadism 13 With Or Without Anosmia and Normosmic Congenital Hypogonadotropic Hypogonadism.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005515 protein binding; GO:0031773 kisspeptin receptor binding
  • GO BP:  GO:0007010 cytoskeleton organization; GO:0007186 G protein-coupled receptor signaling pathway; GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0008285 negative regulation of cell population proliferation; GO:0033686 positive regulation of luteinizing hormone secretion; GO:0043410 positive regulation of MAPK cascade; GO:0050806 positive regulation of synaptic transmission; GO:0060112 generation of ovulation cycle rhythm; GO:0060124 positive regulation of growth hormone secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0016324 apical plasma membrane; GO:0043025 neuronal cell body

Sequence Information

  • Sequence:  GTSLSPPPESSGSPQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF
  • Length:  54
  • Propeptide:  MNSLVSWQLLLFLCATHFGEPLEKVASVGNSRPTGQQLESLGLLAPGEQSLPCTERKPAATARLSRRGTSLSPPPESSGSPQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRFGKREAAPGNHGRSAGRG
  • Signal peptide:  MNSLVSWQLLLFLCATHFG
  • Modification:  T45 Phosphotyrosine;T54 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibit cell proliferation and cell migration, key characteristics of tumor metastasis.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  KISS1R
  • Target Unid:  Q969F8
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q15726-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002282_AF2.pdbhor002282_ESM.pdb

Physical Information

Mass: 674491 Formula: C257H395N75O79
Absent amino acids: CM Common amino acids: PS
pI: 9.3 Basic residues: 5
Polar residues: 18 Hydrophobic residues: 14
Hydrophobicity: -77.59 Boman Index: -9882
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 59.63
Instability Index: 7932.78 Extinction Coefficient cystines: 6990
Absorbance 280nm: 131.89

Literature

  • PubMed ID:  NA
  • Title:  NA