General Information

  • ID:  hor002240
  • Uniprot ID:  A0A0U2JTI1
  • Protein name:  Lom-K
  • Gene name:  NA
  • Organism:  Periplaneta americana (American cockroach) (Blatta americana)
  • Family:  Kinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Periplaneta (genus), Blattinae (subfamily), Blattidae (family), Blattoidea (superfamily), Blattodea (order), Dictyoptera (superorder), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  AFSSWG
  • Length:  6(165-170)
  • Propeptide:  MTSWRRESLASIVGVENEVQHSVAGRKESGALQHRGQHQEEGFSSWGGKRSPAFNSWGGKRSNSFSIVSNRHPLFNSWGGGSEPSFNVLSRDEGPAFRVVSGKRRPSFNSWGGKRDASFSSWGGKRNPAFSILGSSSSEDPPFSIIGGVDQPAFSIVGGEKRLPAFSSWGGKRDPAFKILGNHEYPAFSVLGNNYEPAFSIIPSKRDSPFSSWGGKRDPAFSSWGGKREPSFNSWGGKRDPAFSSWGGKRDDIVS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A0U2JTI1-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002240_AF2.pdbhor002240_ESM.pdb

Physical Information

Mass: 74305 Formula: C31H39N7O9
Absent amino acids: CDEHIKLMNPQRTVY Common amino acids: S
pI: 6.11 Basic residues: 0
Polar residues: 3 Hydrophobic residues: 3
Hydrophobicity: 28.33 Boman Index: 126
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 16.67
Instability Index: 2315 Extinction Coefficient cystines: 5500
Absorbance 280nm: 1100

Literature

  • PubMed ID:  9350979
  • Title:  Isolation and Structural Elucidation of Eight Kinins From the Retrocerebral Complex of the American Cockroach, Periplaneta Americana