General Information

  • ID:  hor002238
  • Uniprot ID:  A0A0U2JTI1
  • Protein name:  Lem-K-7
  • Gene name:  NA
  • Organism:  Periplaneta americana (American cockroach) (Blatta americana)
  • Family:  Kinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Periplaneta (genus), Blattinae (subfamily), Blattidae (family), Blattoidea (superfamily), Blattodea (order), Dictyoptera (superorder), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  DPAFSSWG
  • Length:  8(218-225)
  • Propeptide:  MTSWRRESLASIVGVENEVQHSVAGRKESGALQHRGQHQEEGFSSWGGKRSPAFNSWGGKRSNSFSIVSNRHPLFNSWGGGSEPSFNVLSRDEGPAFRVVSGKRRPSFNSWGGKRDASFSSWGGKRNPAFSILGSSSSEDPPFSIIGGVDQPAFSIVGGEKRLPAFSSWGGKRDPAFKILGNHEYPAFSVLGNNYEPAFSIIPSKRDSPFSSWGGKRDPAFSSWGGKREPSFNSWGGKRDPAFSSWGGKRDDIVS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A0U2JTI1-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002238_AF2.pdbhor002238_ESM.pdb

Physical Information

Mass: 99093 Formula: C40H51N9O13
Absent amino acids: CEHIKLMNQRTVY Common amino acids: S
pI: 3.75 Basic residues: 0
Polar residues: 3 Hydrophobic residues: 3
Hydrophobicity: -42.5 Boman Index: -746
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 12.5
Instability Index: 4393.75 Extinction Coefficient cystines: 5500
Absorbance 280nm: 785.71

Literature

  • PubMed ID:  9350979
  • Title:  Isolation and Structural Elucidation of Eight Kinins From the Retrocerebral Complex of the American Cockroach, Periplaneta Americana