General Information

  • ID:  hor002198
  • Uniprot ID:  P01348
  • Protein name:  Relaxin A chain
  • Gene name:  RLN
  • Organism:  Sus scrofa (Pig)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0001556 oocyte maturation; GO:0001832 blastocyst growth; GO:0007165 signal transduction; GO:0030317 flagellated sperm motility; GO:0046326 positive regulation of glucose import; GO:0050679 positive regulation of epithelial cell proliferation; GO:2000344 positive regulation of acrosome reaction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RMTLSEKCCQVGCIRKDIARLC
  • Length:  22(161-182)
  • Propeptide:  MPRLFSYLLGVWLLLSQLPREIPGQSTNDFIKACGRELVRLWVEICGSVSWGRTALSLEEPQLETGPPAETMPSSITKDAEILKMMLEFVPNLPQELKATLSERQPSLRELQQSASKDSNLNFEEFKKIILNRQNEAEDKSLLELKNLGLDKHSRKKRLFRMTLSEKCCQVGCIRKDIARLC
  • Signal peptide:  MPRLFSYLLGVWLLLSQLPREIPG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  RXFP1
  • Target Unid:  A0A5G2QC39
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45882
  • Structure ID:  AF-P01348-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002198_AF2.pdbhor002198_ESM.pdb

Physical Information

Mass: 290187 Formula: C102H184N34O30S5
Absent amino acids: FHNPWY Common amino acids: C
pI: 8.69 Basic residues: 5
Polar residues: 7 Hydrophobic residues: 6
Hydrophobicity: 3.64 Boman Index: -4896
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 88.64
Instability Index: 627.73 Extinction Coefficient cystines: 250
Absorbance 280nm: 11.9

Literature

  • PubMed ID:  876374
  • Title:  Primary Structure of Porcine Relaxin: Homology With Insulin and Related Growth Factors.
  • PubMed ID:  938497
  • Title:  Primary Structure of the A Chain of Porcine Relaxin