General Information

  • ID:  hor002196
  • Uniprot ID:  Q8HY17
  • Protein name:  Relaxin-3 A chain
  • Gene name:  RLN3
  • Organism:  Sus scrofa (Pig)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DVLAGLSSNCCKWGCSKSEISSLC
  • Length:  24(117-140)
  • Propeptide:  MAKRPLLLLLLAVWVLAGELWLRTEARASPYGVKLCGREFIRAVIFTCGGSRWRRSDMLAHEALGDVFSDTDSNADSELDEAMASSEWLALTKSPETFYGVQPGWQRTPGALRGSRDVLAGLSSNCCKWGCSKSEISSLC
  • Signal peptide:  MAKRPLLLLLLAVWVLAGELWLRTEA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May play a role in neuropeptide signaling processes
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  RXFP4
  • Target Unid:   Q5Y982
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45945
  • Structure ID:  AF-Q8HY17-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002196_AF2.pdbhor002196_ESM.pdb

Physical Information

Mass: 290130 Formula: C102H168N28O36S4
Absent amino acids: FHMPQRTY Common amino acids: S
pI: 6.1 Basic residues: 2
Polar residues: 13 Hydrophobic residues: 7
Hydrophobicity: 29.58 Boman Index: -1881
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 81.25
Instability Index: 3616.25 Extinction Coefficient cystines: 5750
Absorbance 280nm: 250

Literature

  • PubMed ID:  14522968
  • Title:  Identification of relaxin-3/INSL7 as an Endogenous Ligand for the Orphan G-protein-coupled Receptor GPCR135