General Information

  • ID:  hor002156
  • Uniprot ID:  Q9TQY7
  • Protein name:  Insulin B chain
  • Gene name:  INS
  • Organism:  Ornithorhynchus anatinus (Duckbill platypus)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ornithorhynchus (genus), Ornithorhynchidae (family), Monotremata (order), Prototheria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  FPNQHLCGSHLVEALYLVCGEKGFYYIPRM
  • Length:  30(1-30)
  • Propeptide:  FPNQHLCGSHLVEALYLVCGEKGFYYIPRMGIVEECCKGVCSMYQLENYCN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9TQY7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002156_AF2.pdbhor002156_ESM.pdb

Physical Information

Mass: 400354 Formula: C161H238N40O41S3
Absent amino acids: DTW Common amino acids: L
pI: 7.41 Basic residues: 4
Polar residues: 10 Hydrophobic residues: 10
Hydrophobicity: 15 Boman Index: -1123
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 87.67
Instability Index: 1973.67 Extinction Coefficient cystines: 4595
Absorbance 280nm: 158.45

Literature

  • PubMed ID:  8868070
  • Title:  Platypus insulin: indications from the amino acid sequence of significant differences in structure from porcine insulin.