General Information

  • ID:  hor002154
  • Uniprot ID:  P81025
  • Protein name:  Insulin B chain
  • Gene name:  ins
  • Organism:  Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oreochromis (genus), Oreochromini (tribe), Pseudocrenilabrinae (subfamily), African cichlids, Cichlidae (family), Cichliformes (order), Cichlomorphae (superorder), Ovalentaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  VGGPQHLCGSHLVDALYLVCGDRGFFYNPR
  • Length:  30(25-54)
  • Propeptide:  MAALWLQAFSLLVLMMVSWPGSQAVGGPQHLCGSHLVDALYLVCGDRGFFYNPRRDVDPLLGFLPPKAGGAVVQGGENEVTFKDQMEMMVKRGIVEECCHKPCTIFDLQNYCN
  • Signal peptide:  MAALWLQAFSLLVLMMVSWPGSQA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P81025-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002154_AF2.pdbhor002154_ESM.pdb

Physical Information

Mass: 380922 Formula: C148H220N42O40S2
Absent amino acids: EIKMTW Common amino acids: G
pI: 7.41 Basic residues: 4
Polar residues: 11 Hydrophobic residues: 10
Hydrophobicity: 7.33 Boman Index: -2563
Half-Life / Aliphatic Index: 100 hour Aliphatic Index: 84.33
Instability Index: 1441 Extinction Coefficient cystines: 3105
Absorbance 280nm: 107.07

Literature

  • PubMed ID:  7656183
  • Title:  Characterization of the pancreatic hormones from the Brockmann body of the tilapia: implications for islet xenograft studies.