General Information

  • ID:  hor002153
  • Uniprot ID:  Q02816
  • Protein name:  Insulin-like growth factor II
  • Gene name:  igf2
  • Organism:  Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005178 integrin binding; GO:0005179 hormone activity; GO:0008083 growth factor activity
  • GO BP:  GO:0007165 signal transduction; GO:0008284 positive regulation of cell population proliferation
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  EVASAETLCGGELVDALQFVCEDRGFYFSRPTSRSNSRRSQNRGIVEECCFRSCDLNLLEQYCAKPAKSE
  • Length:  70(48-117)
  • Propeptide:  METQKRHEYHSVCHTCRRTENTRMKVKMMSSSNRVLVIALALTLYIVEVASAETLCGGELVDALQFVCEDRGFYFSRPTSRSNSRRSQNRGIVEECCFRSCDLNLLEQYCAKPAKSERDVSATSLQIIPMVPTIKQDVPRKHVTVKYSKYEAWQRKAAQRLRRGVPAILRARKFRRQAVKIKAQEQAMFHRPLITLPSKLPPVLPPTDNYVSHN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  9-50; 21-63; 49-54
  • Structure ID:  AF-Q02816-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002153_AF2.pdbhor002153_ESM.pdb

Physical Information

Mass: 910268 Formula: C332H525N99O111S6
Absent amino acids: HMW Common amino acids: ESR
pI: 4.72 Basic residues: 9
Polar residues: 25 Hydrophobic residues: 20
Hydrophobicity: -49.57 Boman Index: -18233
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 62.71
Instability Index: 7854.14 Extinction Coefficient cystines: 3355
Absorbance 280nm: 48.62

Literature

  • PubMed ID:  1409585
  • Title:  Identification of a Second Insulin-Like Growth Factor in a Fish Species