HORDB

ID: hor002145
Uniprot ID: P41694
Protein name: Insulin-like growth factor II
Gene name: IGF2
Organism: Neovison vison (American mink) (Mustela vison)
Family: Insulin family
Source: Animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Neogale (genus), Mustelinae (subfamily), Mustelidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005178 integrin binding; GO:0005179 hormone activity; GO:0008083 growth factor activity
GO BP: GO:0000122 negative regulation of transcription by RNA polymerase II; GO:0001503 ossification; GO:0001892 embryonic placenta development; GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction; GO:0008284 positive regulation of cell population proliferation; GO:0051147 regulation of muscle cell differentiation; GO:0051148 negative regulation of muscle cell differentiation; GO:0051781 positive regulation of cell division
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSSRGIVEECCFRSCDLALLETYCATPAKSE
Length: 68(25-92)
Propeptide: MGVPMGKSLLAPLTFLALASCCFAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSSRGIVEECCFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWKQSAQRLRR
Signal peptide: MGVPMGKSLLAPLTFLALASCCFA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: The insulin-like growth factors possess growth-promoting activity. Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF-II is influenced by placental lactogen. Also involved in tissue differentiation. Positi
Mechanism: The IGF2 locus is imprinted. Paternal inherited gene is expressed, while the maternal inherited gene is imprinted, hence silenced.
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
Kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002145_AF2.pdb

hor002145_ESM.pdb

Mass:	875776	Formula:	C324H510N94O103S6
Absent amino acids:	HMNW	Common amino acids:	RS
pI:	6.34	Basic residues:	9
Polar residues:	26	Hydrophobic residues:	20
Hydrophobicity:	-22.79	Boman Index:	-15142
Half-Life / Aliphatic Index:	4.4 hour	Aliphatic Index:	64.56
Instability Index:	8024.56	Extinction Coefficient cystines:	4845
Absorbance 280nm:	72.31

PubMed ID: 7686523
Title: Insulin-like growth factor II in the mink (Mustela vison): determination of a cDNA nucleotide sequence and developmental regulation of its expression.