HORDB

ID: hor002113
Uniprot ID: O73727
Protein name: Insulin A chain
Gene name: INS
Organism: Danio rerio (Zebrafish) (Brachydanio rerio)
Family: Insulin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Danio (genus), Danioninae (subfamily), Danionidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0003309 type B pancreatic cell differentiation; GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction; GO:0009749 response to glucose; GO:0031667 response to nutrient levels; GO:2000228 positive regulation of pancreatic A cell differentiation; GO:2000252 negative regulation of feeding behavior
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: GIVEQCCHKPCSIFELQNYCN
Length: 21
Propeptide: MAVWLQAGALLVLLVVSSVSTNPGTPQHLCGSHLVDALYLVCGPTGFFYNPKRDVEPLLGFLPPKSAQETEVADFAFKDHAELIRKRGIVEQCCHKPCSIFELQNYCN
Signal peptide: MAVWLQAGALLVLLVVSSVST
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002113_AF2.pdb

hor002113_ESM.pdb

Mass:	278573	Formula:	C103H158N28O32S4
Absent amino acids:	ADMRTW	Common amino acids:	C
pI:	5.48	Basic residues:	2
Polar residues:	9	Hydrophobic residues:	5
Hydrophobicity:	-11.43	Boman Index:	-2389
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	69.52
Instability Index:	4216.19	Extinction Coefficient cystines:	1740
Absorbance 280nm:	87