General Information

  • ID:  hor002109
  • Uniprot ID:  Q90325
  • Protein name:  Insulin-like growth factor I
  • Gene name:  NA
  • Organism:  Cyprinus carpio (Common carp)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cyprinus (genus), Cyprininae (subfamily), Cyprinidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0008083 growth factor activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  GPETLCGAELVDTLQFVCGDRGFYFSKPTGYGPSSRRSHNRGIVDECCFQSCELRRLEMYCAPVKPGKTP
  • Length:  70(45-114)
  • Propeptide:  MSSGHFFQGHWCDVFKCTMRCLSCTHTLSLVLCVLALTPATLEAGPETLCGAELVDTLQFVCGDRGFYFSKPTGYGPSSRRSHNRGIVDECCFQSCELRRLEMYCAPVKPGKTPRSLRAQRHTDSPRTPKKPISGHSHSSCKEVHQKNSSRGNTGGRNYRM
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. Binds to integrins.
  • Mechanism:  Binds to the alpha subunit of IGF1R, leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiatiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  6-48; 18-61; 47-52
  • Structure ID:  AF-Q90325-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002109_AF2.pdbhor002109_ESM.pdb

Physical Information

Mass: 899374 Formula: C336H522N96O102S7
Absent amino acids: W Common amino acids: G
pI: 7.75 Basic residues: 10
Polar residues: 27 Hydrophobic residues: 16
Hydrophobicity: -45.57 Boman Index: -13769
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 52.86
Instability Index: 6270.57 Extinction Coefficient cystines: 4845
Absorbance 280nm: 70.22

Literature

  • PubMed ID:  9137817
  • Title:  Molecular cloning and growth hormone-regulated gene expression of carp insulin-like growth factor-I.