HORDB

ID: hor002086
Uniprot ID: P13190
Protein name: Insulin A chain
Gene name: INS
Organism: Callorhinchus milii (Ghost shark)
Family: Insulin family
Source: Animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Callorhinchus (genus), Callorhinchidae (family), Chimaeriformes (order), Holocephali (subclass), Chondrichthyes (class), Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region

Sequence: GIVEQCCHNTCSLVNLEGYCN
Length: 21(69-89)
Propeptide: VPTQRLCGSHLVDALYFVCGERGFFYSPKQIRDVGPLSAFRDLEPPLDTEMEDRFPYRQQLAGSKMKRGIVEQCCHNTCSLVNLEGYCN
Signal peptide: NA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Mechanism: NA
Cross BBB: NA
Target: insr
Target Unid: A0A4W3HGM8
IC50: NA
EC50: NA
ED50: NA
Kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002086_AF2.pdb

hor002086_ESM.pdb

Mass:	265653	Formula:	C93H147N27O33S4
Absent amino acids:	ADFKMPRW	Common amino acids:	C
pI:	4.25	Basic residues:	1
Polar residues:	12	Hydrophobic residues:	5
Hydrophobicity:	12.86	Boman Index:	-2001
Half-Life / Aliphatic Index:	30 hour	Aliphatic Index:	83.33
Instability Index:	2573.33	Extinction Coefficient cystines:	1740
Absorbance 280nm:	87

PubMed ID: 2690815
Title: Isolation and structural characterization of insulin and glucagon from the holocephalan species Callorhynchus milii (elephantfish).