HORDB

ID: hor002074
Uniprot ID: P01333
Protein name: Insulin A chain
Gene name: INS
Organism: Anas platyrhynchos (Mallard) (Anas boschas)
Family: Insulin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Anas (genus), Anatinae (subfamily), Anatidae (family), Anseriformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region

Sequence: GIVEQCCENPCSLYQLENYCN
Length: 21
Propeptide: AANQHLCGSHLVEALYLVCGERGFFYSPKTXXDVEQPLVNGPLHGEVGELPFQHEEYQXXGIVEQCCENPCSLYQLENYCN
Signal peptide: NA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002074_AF2.pdb

hor002074_ESM.pdb

Mass:	277963	Formula:	C100H152N26O36S4
Absent amino acids:	ADFHKMRTW	Common amino acids:	C
pI:	3.47	Basic residues:	0
Polar residues:	11	Hydrophobic residues:	4
Hydrophobicity:	-33.81	Boman Index:	-3025
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	69.52
Instability Index:	205.71	Extinction Coefficient cystines:	3230
Absorbance 280nm:	161.5