General Information

  • ID:  hor002061
  • Uniprot ID:  P07223
  • Protein name:  Molluscan insulin-related peptide 1 B chain
  • Gene name:  NA
  • Organism:  Lymnaea stagnalis (Great pond snail) (Helix stagnalis)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  Expressed in the cerebral light-green cells which are giant neuroendocrines cells involved in the control of growth.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lymnaea (genus), Lymnaeidae (family), Lymnaeoidea (superfamily), Hygrophila, Panpulmonata, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0030133 transport vesicle; GO:0031410 cytoplasmic vesicle

Sequence Information

  • Sequence:  QFSACNINDRPHRRGVCGSALADLVDFACSSSNQPA
  • Length:  36
  • Propeptide:  MAGVRLVFTKAFMVTVLLTLLLNIGVKPAEGQFSACNINDRPHRRGVCGSALADLVDFACSSSNQPAMVKRNAETDLDDPLRNIKLSSESALTYLTKRQGTTNIVCECCMKPCTLSELRQYCP
  • Signal peptide:  MAGVRLVFTKAFMVTVLLTLLLNIGVKPAEG
  • Modification:  T1 Pyrrolidone carboxylic acid
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P07223-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002061_AF2.pdbhor002061_ESM.pdb

Physical Information

Mass: 443268 Formula: C157H248N52O53S3
Absent amino acids: EKMTWY Common amino acids: AS
pI: 7.18 Basic residues: 4
Polar residues: 13 Hydrophobic residues: 12
Hydrophobicity: -28.06 Boman Index: -8001
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 62.5
Instability Index: 7173.06 Extinction Coefficient cystines: 125
Absorbance 280nm: 3.57

Literature

  • PubMed ID:  1526314
  • Title:  Purification and Sequencing of Molluscan Insulin-Related Peptide I (MIP I) From the Neuroendocrine Light Green Cells of Lymnaea Stagnalis