General Information

  • ID:  hor002060
  • Uniprot ID:  P15131
  • Protein name:  LIRP B chain
  • Gene name:  NA
  • Organism:  Locusta migratoria (Migratory locust)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Locusta (genus), Oedipodinae (subfamily), Acrididae (family), Acridoidea (superfamily), Acridomorpha, Acrididea (infraorder), Caelifera (suborder), Orthoptera (order), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SGAPQPVARYCGEKLSNALKLVCRGNYNTMF
  • Length:  31
  • Propeptide:  MWKLCLRLLAVLAVCLSTATQAQSDLFLLSPKRSGAPQPVARYCGEKLSNALKLVCRGNYNTMFKKASQDVSDSESEDNYWSGQSADEAAEAAAAALPPYPILARPSAGGLLTGAVFRRRTRGVFDECCRKSCSISELQTYCGRR
  • Signal peptide:  MWKLCLRLLAVLAVCLSTA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P15131-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002060_AF2.pdbhor002060_ESM.pdb

Physical Information

Mass: 392421 Formula: C147H235N43O43S3
Absent amino acids: DHIW Common amino acids: AGLN
pI: 9.37 Basic residues: 4
Polar residues: 13 Hydrophobic residues: 9
Hydrophobicity: -28.06 Boman Index: -4388
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 66.13
Instability Index: 1049.35 Extinction Coefficient cystines: 3105
Absorbance 280nm: 103.5

Literature

  • PubMed ID:  1935945
  • Title:  Isolation and structural characterization of an insulin-related molecule, a predominant neuropeptide from Locusta migratoria.