General Information

  • ID:  hor002059
  • Uniprot ID:  P15131
  • Protein name:  5 kDa peptide
  • Gene name:  NA
  • Organism:  Locusta migratoria (Migratory locust)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Locusta (genus), Oedipodinae (subfamily), Acrididae (family), Acridoidea (superfamily), Acridomorpha, Acrididea (infraorder), Caelifera (suborder), Orthoptera (order), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ASQDVSDSESEDNYWSGQSADEAAEAAAAALPPYPILARPSAGGLLTGAV
  • Length:  50(67-116)
  • Propeptide:  MWKLCLRLLAVLAVCLSTATQAQSDLFLLSPKRSGAPQPVARYCGEKLSNALKLVCRGNYNTMFKKASQDVSDSESEDNYWSGQSADEAAEAAAAALPPYPILARPSAGGLLTGAVFRRRTRGVFDECCRKSCSISELQTYCGRR
  • Signal peptide:  MWKLCLRLLAVLAVCLSTA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Could correspond to spacer peptides
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P15131-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002059_AF2.pdbhor002059_ESM.pdb

Physical Information

Mass: 585250 Formula: C214H327N57O80
Absent amino acids: CFHKM Common amino acids: A
pI: 3.4 Basic residues: 1
Polar residues: 15 Hydrophobic residues: 20
Hydrophobicity: -22.2 Boman Index: -6092
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 74.6
Instability Index: 6258 Extinction Coefficient cystines: 8480
Absorbance 280nm: 173.06

Literature

  • PubMed ID:  2298206
  • Title:  Isolation and Structure Elucidation of a Novel 5-kDa Peptide From Neurohaemal Lobes of the Corpora Cardiaca of Locusta Migratoria (Insecta, Orthoptera)