General Information

  • ID:  hor002058
  • Uniprot ID:  P15131
  • Protein name:  LIRP A chain
  • Gene name:  NA
  • Organism:  Locusta migratoria (Migratory locust)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Locusta (genus), Oedipodinae (subfamily), Acrididae (family), Acridoidea (superfamily), Acridomorpha, Acrididea (infraorder), Caelifera (suborder), Orthoptera (order), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GVFDECCRKSCSISELQTYCG
  • Length:  21
  • Propeptide:  MWKLCLRLLAVLAVCLSTATQAQSDLFLLSPKRSGAPQPVARYCGEKLSNALKLVCRGNYNTMFKKASQDVSDSESEDNYWSGQSADEAAEAAAAALPPYPILARPSAGGLLTGAVFRRRTRGVFDECCRKSCSISELQTYCGRR
  • Signal peptide:  MWKLCLRLLAVLAVCLSTA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  6-11
  • Structure ID:  AF-P15131-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002058_AF2.pdbhor002058_ESM.pdb

Physical Information

Mass: 268555 Formula: C95H150N26O34S4
Absent amino acids: AHMNPW Common amino acids: C
pI: 4.43 Basic residues: 2
Polar residues: 11 Hydrophobic residues: 4
Hydrophobicity: -10.95 Boman Index: -3740
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 50.95
Instability Index: 7654.29 Extinction Coefficient cystines: 1740
Absorbance 280nm: 87

Literature

  • PubMed ID:  1935945
  • Title:  Isolation and structural characterization of an insulin-related molecule, a predominant neuropeptide from Locusta migratoria.