General Information

  • ID:  hor002055
  • Uniprot ID:  Q9NDE7
  • Protein name:  Insulin A chain
  • Gene name:  PIN
  • Organism:  Aplysia californica (California sea hare)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  Expressed in the central region of the cerebral ganglia mostly within the F and C clusters.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  EASGSITCECCFNQCRIFELAQYCRLPDHFFSRIS
  • Length:  35(105-139)
  • Propeptide:  MSKFLLQSHSANACLLTLLLTLASNLDISLANFEHSCNGYMRPHPRGLCGEDLHVIISNLCSSLGGNRRFLAKYMVKRDTENVNDKLRGILLNKKEAFSYLTKREASGSITCECCFNQCRIFELAQYCRLPDHFFSRISRTGRSNSGHAQLEDNFS
  • Signal peptide:  MSKFLLQSHSANACLLTLLLTLASNLDISLA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Involved in glucose metabolism
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45880
  • Structure ID:  AF-Q9NDE7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002055_AF2.pdbhor002055_ESM.pdb

Physical Information

Mass: 468227 Formula: C176H265N49O53S5
Absent amino acids: KMVW Common amino acids: C
pI: 5.6 Basic residues: 4
Polar residues: 13 Hydrophobic residues: 11
Hydrophobicity: 0 Boman Index: -6512
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 61.43
Instability Index: 2169.43 Extinction Coefficient cystines: 1740
Absorbance 280nm: 51.18

Literature

  • PubMed ID:  10479677
  • Title:  Insulin prohormone processing, distribution, and relation to metabolism in Aplysia californica.