General Information

  • ID:  hor002025
  • Uniprot ID:  O97686
  • Protein name:  Progonadoliberin-2
  • Gene name:  GNRH2
  • Organism:  Suncus murinus (Asian house shrew) (Musk shrew)
  • Family:  GnRH family
  • Source:  Animal
  • Expression:  Midbrain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Suncus (genus), Crocidurinae (subfamily), Soricidae (family), Eulipotyphla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSHGWYPGGKRSPDSPQDPQPAPRFPEGYWLGLAAGNPRQSTQSLPSKALAPPEDTVSEEAKTMAWWHLQKQRLIQTLLPRP
  • Length:  84(27-110)
  • Propeptide:  MASIGQGLVLLLLLLLLTAQPGPLKAQHWSHGWYPGGKRSPDSPQDPQPAPRFPEGYWLGLAAGNPRQSTQSLPSKALAPPEDTVSEEAKTMAWWHLQKQRLIQTLLPRP
  • Signal peptide:  MASIGQGLVLLLLLLLLTAQPGPLKA
  • Modification:  T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O97686-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002025_AF2.pdbhor002025_ESM.pdb

Physical Information

Mass: 1097427 Formula: C429H645N123O121S
Absent amino acids: C Common amino acids: P
pI: 9.81 Basic residues: 12
Polar residues: 20 Hydrophobic residues: 23
Hydrophobicity: -102.38 Boman Index: -16589
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 53.57
Instability Index: 9131.43 Extinction Coefficient cystines: 30480
Absorbance 280nm: 367.23

Literature

  • PubMed ID:  NA
  • Title:  NA