General Information

  • ID:  hor002024
  • Uniprot ID:  Q28588
  • Protein name:  GnRH-associated peptide 1
  • Gene name:  GNRH1
  • Organism:  Ovis aries (Sheep)
  • Family:  GnRH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0033684 regulation of luteinizing hormone secretion; GO:0046880 regulation of follicle-stimulating hormone secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  NAKNVIDSFQEIAKEVDQPVEPKCCGCIVHQSHSPLRDLKAALESLIE
  • Length:  48(14-61)
  • Propeptide:  QHWSYGLRPGGKRNAKNVIDSFQEIAKEVDQPVEPKCCGCIVHQSHSPLRDLKAALESLIE
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  GNRHR
  • Target Unid:  P32237
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q28588-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002024_AF2.pdbhor002024_ESM.pdb

Physical Information

Mass: 614260 Formula: C229H374N64O74S3
Absent amino acids: MTWY Common amino acids: E
pI: 4.88 Basic residues: 7
Polar residues: 10 Hydrophobic residues: 17
Hydrophobicity: -26.88 Boman Index: -7963
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 97.5
Instability Index: 6268.54 Extinction Coefficient cystines: 125
Absorbance 280nm: 2.66

Literature

  • PubMed ID:  NA
  • Title:  NA