General Information

  • ID:  hor002019
  • Uniprot ID:  P37042
  • Protein name:  GnRH-associated peptide 1
  • Gene name:  GNRH1
  • Organism:  Gallus gallus (Chicken)
  • Family:  GnRH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Gallus (genus), Phasianinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity; GO:0005515 protein binding; GO:0031530 gonadotropin-releasing hormone receptor binding
  • GO BP:  GO:0000003 reproduction; GO:0007165 signal transduction; GO:0032275 luteinizing hormone secretion; GO:0033686 positive regulation of luteinizing hormone secretion; GO:0043279 response to alkaloid; GO:0046885 regulation of hormone biosynthetic process; GO:1904014 response to serotonin; GO:2000843 regulation of testosterone secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  NAENLVESFQEIANEMESLGEGQKAECPGSYQHPRLSDLKETMASLIEGEARRKEI
  • Length:  56(37-92)
  • Propeptide:  MEKSRKILVGVLLFTASVAICLAQHWSYGLQPGGKRNAENLVESFQEIANEMESLGEGQKAECPGSYQHPRLSDLKETMASLIEGEARRKEI
  • Signal peptide:  MEKSRKILVGVLLFTASVAICLA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  GNRHR
  • Target Unid:   B5G4W1
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P37042-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002019_AF2.pdbhor002019_ESM.pdb

Physical Information

Mass: 724612 Formula: C264H426N76O94S3
Absent amino acids: W Common amino acids: E
pI: 4.26 Basic residues: 7
Polar residues: 15 Hydrophobic residues: 15
Hydrophobicity: -84.64 Boman Index: -14078
Half-Life / Aliphatic Index: 1.4 hour Aliphatic Index: 69.82
Instability Index: 5251.25 Extinction Coefficient cystines: 1490
Absorbance 280nm: 27.09

Literature

  • PubMed ID:  NA
  • Title:  NA