HORDB

ID: hor002014
Uniprot ID: O54713
Protein name: Progonadoliberin-1
Gene name: GNRH1
Organism: Cavia porcellus (Guinea pig)
Family: GnRH family
Source: Animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Cavia (genus), Caviidae (family), Hystricomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity
GO BP: GO:0007165 signal transduction; GO:0010468 regulation of gene expression; GO:0045471 response to ethanol; GO:0048545 response to steroid hormone; GO:2000354 regulation of ovarian follicle development; GO:2001223 negative regulation of neuron migration
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: QYWSYGVRPGGKRNIEPLVDSFQEMAKEIDQLAEPQHFECTLHQPRSPLRDLKGALESLMEEETGQKKI
Length: 69(24-92)
Propeptide: MGLIPKLLAGLVLLTLCVENGSGQYWSYGVRPGGKRNIEPLVDSFQEMAKEIDQLAEPQHFECTLHQPRSPLRDLKGALESLMEEETGQKKI
Signal peptide: MGLIPKLLAGLVLLTLCVENGSG
Modification: T1 Pyrrolidone carboxylic acid;T10 Glycine amide
Glycosylation: NA
Mutagenesis: NA

Function: Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
Mechanism: NA
Cross BBB: NA
Target: Gnrhr
Target Unid: Q8CH60
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002014_AF2.pdb

hor002014_ESM.pdb

Mass:	919810	Formula:	C351H552N98O109S3
Absent amino acids:		Common amino acids:	E
pI:	5.08	Basic residues:	11
Polar residues:	15	Hydrophobic residues:	18
Hydrophobicity:	-90.87	Boman Index:	-16142
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	69.28
Instability Index:	7788.99	Extinction Coefficient cystines:	8480
Absorbance 280nm:	124.71