HORDB

ID: hor002010
Uniprot ID: F6PLR0
Protein name: t-GnRH-6
Gene name: gnrh1
Organism: Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis)
Family: GnRH family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Ciona (genus), Cionidae (family), Phlebobranchia (order), Ascidiacea (class), Tunicata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region

Sequence: QHWSYEYMPG
Length: 10
Propeptide: MLDIEKDELAALLQRENSAFRDILYHKNAGSFEKSDSGKFDSLKLQNNFPHLDLGLGVDLDAVDQWNRYKQANAQRMQNLGVPVNARQHWSYEFMPGGRRAVWENANVGVPVSRQHWSYEYMPGGRRSAGQHAMTKRQHWSKGYSPGGKRSVDLSEFDDQGRRITKHEGMPEEPFKVEQPRPRNGIHGPAGLDQNEPDWKNWMNEQPAASSDDKGSDVE
Signal peptide: NA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002010_AF2.pdb

hor002010_ESM.pdb

Mass:	145811	Formula:	C60H76N14O17S
Absent amino acids:	ACDFIKLNRTV	Common amino acids:	Y
pI:	5.36	Basic residues:	1
Polar residues:	4	Hydrophobic residues:	1
Hydrophobicity:	-146	Boman Index:	-1507
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	0
Instability Index:	8646	Extinction Coefficient cystines:	8480
Absorbance 280nm:	942.22

PubMed ID: 21467196
Title: Peptidomic Analysis of the Central Nervous System of the Protochordate, Ciona Intestinalis: Homologs and Prototypes of Vertebrate Peptides and Novel Peptides