HORDB

ID: hor002007
Uniprot ID: F6PLR0
Protein name: t-GnRH-5
Gene name: gnrh1
Organism: Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis)
Family: GnRH family
Source: Animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Ciona (genus), Cionidae (family), Phlebobranchia (order), Ascidiacea (class), Tunicata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region

Sequence: QHWSYEFMPG
Length: 10(88-97)
Propeptide: MLDIEKDELAALLQRENSAFRDILYHKNAGSFEKSDSGKFDSLKLQNNFPHLDLGLGVDLDAVDQWNRYKQANAQRMQNLGVPVNARQHWSYEFMPGGRRAVWENANVGVPVSRQHWSYEYMPGGRRSAGQHAMTKRQHWSKGYSPGGKRSVDLSEFDDQGRRITKHEGMPEEPFKVEQPRPRNGIHGPAGLDQNEPDWKNWMNEQPAASSDDKGSDVE
Signal peptide: NA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002007_AF2.pdb

hor002007_ESM.pdb

Mass:	144211	Formula:	C60H76N14O16S
Absent amino acids:	ACDIKLNRTV	Common amino acids:	EFGHMPQSWY
pI:	5.36	Basic residues:	1
Polar residues:	3	Hydrophobic residues:	2
Hydrophobicity:	-105	Boman Index:	-1195
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	0
Instability Index:	4252	Extinction Coefficient cystines:	6990
Absorbance 280nm:	776.67

PubMed ID: 21467196
Title: Peptidomic Analysis of the Central Nervous System of the Protochordate, Ciona Intestinalis: Homologs and Prototypes of Vertebrate Peptides and Novel Peptides