General Information

  • ID:  hor002007
  • Uniprot ID:  F6PLR0(88-97)
  • Protein name:  t-GnRH-5
  • Gene name:  gnrh1
  • Organism:  Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ciona (genus), Cionidae (family), Phlebobranchia (order), Ascidiacea (class), Tunicata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QHWSYEFMPG
  • Length:  10(88-97)
  • Propeptide:  MLDIEKDELAALLQRENSAFRDILYHKNAGSFEKSDSGKFDSLKLQNNFPHLDLGLGVDLDAVDQWNRYKQANAQRMQNLGVPVNARQHWSYEFMPGGRRAVWENANVGVPVSRQHWSYEYMPGGRRSAGQHAMTKRQHWSKGYSPGGKRSVDLSEFDDQGRRITKHEGMPEEPFKVEQPRPRNGIHGPAGLDQNEPDWKNWMNEQPAASSDDKGSDVE
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-F6PLR0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002007_AF2.pdbhor002007_ESM.pdb

Physical Information

Mass: 144211 Formula: C60H76N14O16S
Absent amino acids: ACDIKLNRTV Common amino acids: EFGHMPQSWY
pI: 5.36 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 2
Hydrophobicity: -105 Boman Index: -1195
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 0
Instability Index: 4252 Extinction Coefficient cystines: 6990
Absorbance 280nm: 776.67

Literature

  • PubMed ID:  21467196
  • Title:  Peptidomic Analysis of the Central Nervous System of the Protochordate, Ciona Intestinalis: Homologs and Prototypes of Vertebrate Peptides and Novel Peptides