General Information

  • ID:  hor001999
  • Uniprot ID:  B2KIU3
  • Protein name:  GnRH-II
  • Gene name:  NA
  • Organism:  Petromyzon marinus (Sea lamprey)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  hypothalamus, medulla, and olfactory regions
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Petromyzon (genus), Petromyzontidae (family), Petromyzontiformes (order), Hyperoartia (class), Cyclostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QHWSHGWFPG
  • Length:  10
  • Propeptide:  MNERIDCCLSLALWRMGRASLSLVLILWLLTAPPASLGQHWSHGWFPGGKRGVQEPPRASYENVSPSDGSPFTPVSSGLQVADWHVVCSRSPNGFSGCAMCCSPGCPTFLSQVLEASLGT
  • Signal peptide:  MNERIDCCLSLALWRMGRASLSLVLILWLLTAPPASLG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Induced significant pituitary-gonadal responses
  • Mechanism:  activated the inositol phosphate signaling pathway
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-B2KIU3-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001999_AF2.pdbhor001999_ESM.pdb

Physical Information

Mass: 139904 Formula: C60H71N17O13
Absent amino acids: ACDEIKLMNRTVY Common amino acids: GHW
pI: 7.72 Basic residues: 2
Polar residues: 3 Hydrophobic residues: 3
Hydrophobicity: -121 Boman Index: -874
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 0
Instability Index: 2735 Extinction Coefficient cystines: 11000
Absorbance 280nm: 1222.22

Literature

  • PubMed ID:  18436713
  • Title:  Origins of Gonadotropin-Releasing Hormone (GnRH) in Vertebrates: Identification of a Novel GnRH in a Basal Vertebrate, the Sea Lamprey