General Information

  • ID:  hor001988
  • Uniprot ID:  P09916
  • Protein name:  Somatoliberin
  • Gene name:  Ghrh
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  hypothalamus
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0016608 growth hormone-releasing hormone activity; GO:0031770 growth hormone-releasing hormone receptor binding; GO:0051428 peptide hormone receptor binding
  • GO BP:  GO:0001666 response to hypoxia; GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0008284 positive regulation of cell population proliferation; GO:0010667 negative regulation of cardiac muscle cell apoptotic process; GO:0021984 adenohypophysis development; GO:0030252 growth hormone secretion; GO:0032094 response to food; GO:0032879 regulation of localization; GO:0035264 multicellular organism growth; GO:0040018 positive regulation of multicellular organism growth; GO:0043950 positive regulation of cAMP-mediated signaling; GO:0044321 response to leptin; GO:0045893 positive regulation of DNA-templated transcription; GO:0046005 positive regulation of circadian sleep/wake cycle, REM sleep; GO:0046010 positive regulation of circadian sleep/wake cycle, non-REM sleep; GO:0046879 hormone secretion; GO:0046887 positive regulation of hormone secretion; GO:0060124 positive regulation of growth hormone secretion; GO:0071354 cellular response to interleukin-6; GO:0071548 response to dexamethasone
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0043195 terminal bouton; GO:0043204 perikaryon; GO:0043679 axon terminus

Sequence Information

  • Sequence:  HADAIFTSSYRRILGQLYARKLLHEIMNRQQGERNQEQRSRFN
  • Length:  43(31-73)
  • Propeptide:  MPLWVFFVLLTLTSGSHCSLPPSPPFRVRRHADAIFTSSYRRILGQLYARKLLHEIMNRQQGERNQEQRSRFNRHLDRVWAEDKQMALESILQGFPRMKLSAEA
  • Signal peptide:  MPLWVFFVLLTLTSGSHCS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Acts on the adenohypophyse to stimulate the secretion of growth hormone.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Ghrhr
  • Target Unid:   Q02644
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P09916-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001988_AF2.pdbhor001988_ESM.pdb

Physical Information

Mass: 598220 Formula: C225H361N77O66S
Absent amino acids: CPVW Common amino acids: R
pI: 11.27 Basic residues: 10
Polar residues: 11 Hydrophobic residues: 12
Hydrophobicity: -113.26 Boman Index: -15907
Half-Life / Aliphatic Index: 3.5 hour Aliphatic Index: 70.47
Instability Index: 6612.79 Extinction Coefficient cystines: 2980
Absorbance 280nm: 70.95

Literature

  • PubMed ID:  6406907
  • Title:  Characterization of Rat Hypothalamic Growth Hormone-Releasing Factor.
  • PubMed ID:  6440563
  • Title:  Rat Hypothalamic Growth Hormone-Releasing Factor: Isolation, Sequence Analysis and Total Synthesis