HORDB

ID: hor001987
Uniprot ID: P11384
Protein name: Secretin
Gene name: SCT
Organism: Rattus norvegicus (Rat)
Family: Glucagon family
Source: Animal
Expression: In the brain, expressed in the central amygdala, hippocampus, area postrema, nucleus of the tractus solitary and cerebellum .
Disease: NA
Comments: NA
Taxonomy: Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0001664 G protein-coupled receptor binding; GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0046659 digestive hormone activity
GO BP: GO:0002024 diet induced thermogenesis; GO:0007165 signal transduction; GO:0007420 brain development; GO:0008542 visual learning; GO:0009992 intracellular water homeostasis; GO:0021542 dentate gyrus development; GO:0021766 hippocampus development; GO:0031667 response to nutrient levels; GO:0032098 regulation of appetite; GO:0043524 negative regulation of neuron apoptotic process; GO:0051402 neuron apoptotic process; GO:0097150 neuronal stem cell population maintenance
GO CC: NA

Sequence: HSDGTFTSELSRLQDSARLQRLLQGLV
Length: 27(33-59)
Propeptide: MEPLLPTPPLLLLLLLLLSSSFVLPAPPRTPRHSDGTFTSELSRLQDSARLQRLLQGLVGKRSEEDTENIPENSVARPKPLEDQLCLLWSNTQALQDWLLPRLSLDGSLSLWLPPGPRPAVDHSEWTETTRQPR
Signal peptide: MEPLLPTPPLLLLLLLLLSSS
Modification: T27 Valine amide
Glycosylation: NA
Mutagenesis: NA

Function: Hormone involved in different processes, such as regulation of the pH of the duodenal content, food intake and water homeostasis. Exerts its biological effects by binding to secretin receptor (SCTR), a G-protein coupled receptor expressed in the basolater
Mechanism: NA
Cross BBB: NA
Target: Sctr
Target Unid: P23811
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor001987_AF2.pdb

hor001987_ESM.pdb

Mass:	349232	Formula:	C129H215N41O43
Absent amino acids:	CIKMNPWY	Common amino acids:	L
pI:	7.55	Basic residues:	4
Polar residues:	8	Hydrophobic residues:	9
Hydrophobicity:	-42.59	Boman Index:	-6880
Half-Life:	3.5 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	101.11
Instability Index:	7581.11	Extinction Coefficient cystines:	0
Absorbance 280nm:	0