General Information

  • ID:  hor001960
  • Uniprot ID:  P63292
  • Protein name:  Somatoliberin
  • Gene name:  GHRH
  • Organism:  Bos taurus (Bovine)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  hypothalamus
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0016608 growth hormone-releasing hormone activity; GO:0031770 growth hormone-releasing hormone receptor binding; GO:0051428 peptide hormone receptor binding
  • GO BP:  GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0008284 positive regulation of cell population proliferation; GO:0021984 adenohypophysis development; GO:0030252 growth hormone secretion; GO:0032024 positive regulation of insulin secretion; GO:0032094 response to food; GO:0032880 regulation of protein localization; GO:0035264 multicellular organism growth; GO:0040018 positive regulation of multicellular organism growth; GO:0045745 positive regulation of G protein-coupled receptor signaling pathway; GO:0046879 hormone secretion; GO:0046887 positive regulation of hormone secretion; GO:0060124 positive regulation of growth hormone secretion; GO:0071277 cellular response to calcium ion; GO:1903489 positive regulation of lactation
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0043195 terminal bouton; GO:0043204 perikaryon

Sequence Information

  • Sequence:  YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL
  • Length:  44(31-74)
  • Propeptide:  MLLWVFFLVTLTLSSGSHGSLPSQPLRIPRYADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRLGRQVDGVWTDQQQMALESTLVSLLQERRNSQG
  • Signal peptide:  MLLWVFFLVTLTLSSGSHG
  • Modification:  T44 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Acts on the adenohypophyse to stimulate the secretion of growth hormone
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  GHRHR
  • Target Unid:  Q9TUJ0
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P63292-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001960_AF2.pdbhor001960_ESM.pdb

Physical Information

Mass: 587600 Formula: C220H365N71O67S
Absent amino acids: CHPW Common amino acids: Q
pI: 10.7 Basic residues: 8
Polar residues: 11 Hydrophobic residues: 14
Hydrophobicity: -85.23 Boman Index: -12721
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 84.32
Instability Index: 2671.59 Extinction Coefficient cystines: 2980
Absorbance 280nm: 69.3

Literature

  • PubMed ID:  6421287
  • Title:  Isolation and characterization of the bovine hypothalamic growth hormone releasing factor.