General Information

  • ID:  hor001946
  • Uniprot ID:  P01284
  • Protein name:  Intestinal peptide PHI-27
  • Gene name:  VIP
  • Organism:  Sus scrofa (Pig)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0032880 regulation of protein localization; GO:0045732 positive regulation of protein catabolic process; GO:0048255 mRNA stabilization; GO:0070459 prolactin secretion
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HADGVFTSDFSRLLGQLSAKKYLESLI
  • Length:  27(1-27)
  • Propeptide:  HADGVFTSDFSRLLGQLSAKKYLESLIXXXXXXXXXXXXXXXXXHSDAVFTDNYTRLRKQMAVKKYLNSILNGKR
  • Signal peptide:  NA
  • Modification:  T27 Isoleucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Cause vasodilation
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  VPAC1, VIPR2
  • Target Unid:   Q28992, A0A287AYV5
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q62923-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q62923-F1.pdbhor001946_AF2.pdbhor001946_ESM.pdb

Physical Information

Mass: 346036 Formula: C136H215N35O41
Absent amino acids: CMNPW Common amino acids: L
pI: 7.54 Basic residues: 4
Polar residues: 8 Hydrophobic residues: 11
Hydrophobicity: 5.19 Boman Index: -3176
Half-Life / Aliphatic Index: 3.5 hour Aliphatic Index: 104.81
Instability Index: 1795.93 Extinction Coefficient cystines: 1490
Absorbance 280nm: 57.31

Literature

  • PubMed ID:  6947244
  • Title:  Isolation and characterization of the intestinal peptide porcine PHI (PHI-27), a new member of the glucagon-secretin family.