General Information

  • ID:  hor001945
  • Uniprot ID:  P01287
  • Protein name:  Somatoliberin
  • Gene name:  GHRH
  • Organism:  Sus scrofa (Pig)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  hypothalamus
  • Disease:  NA
  • Comments:  The carboxyl-amidated somatoliberin is twice as active as that having a free carboxyl end.
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0032880 regulation of protein localization
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL
  • Length:  44(1-44)
  • Propeptide:  YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL
  • Signal peptide:  NA
  • Modification:  T44 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulate the secretion of growth hormone
  • Mechanism:  The carboxyl-amidated somatoliberin is twice as active as that having a free carboxyl end.
  • Cross BBB:  NA
  • Target:  GHRHR
  • Target Unid:  P34999
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P04094-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P04094-F1.pdbhor001945_AF2.pdbhor001945_ESM.pdb

Physical Information

Mass: 587698 Formula: C219H364N72O67S
Absent amino acids: CHPW Common amino acids: QR
pI: 10.91 Basic residues: 8
Polar residues: 11 Hydrophobic residues: 14
Hydrophobicity: -80.45 Boman Index: -13334
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 84.32
Instability Index: 4300.91 Extinction Coefficient cystines: 2980
Absorbance 280nm: 69.3

Literature

  • PubMed ID:  6418166
  • Title:  Isolation and Characterization of the Porcine Hypothalamic Growth Hormone Releasing Factor