General Information

  • ID:  hor001928
  • Uniprot ID:  Q09169
  • Protein name:  Pituitary adenylate cyclase-activating polypeptide 38
  • Gene name:  adcyap1
  • Organism:  Pelophylax ridibundus (Marsh frog) (Rana ridibunda)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Pelophylax (genus), Ranidae (family), Ranoidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRIKNK
  • Length:  38(127-164)
  • Propeptide:  MYRKALLVWLLVYGIMRCTVHSSPTALKYPALRLEDEVYDEDGNTLPDFAFDNNPIGIGNPASVFDDMYSFYYPAEKRHADDLLNKAYRNLLGQLSARKYLHTLMAKHLGAVSSSLEDDSEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRIKNKGRRVAYL
  • Signal peptide:  MYRKALLVWLLVYGIMRCTVHS
  • Modification:  T38 Lysine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  PACAP plays pivotal roles as a neurotransmitter and/or a neuromodulator. Stimulates adenylate cyclase in pituitary cells.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: 2.1+/-0.6*10(-7)M
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q09169-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001928_AF2.pdbhor001928_ESM.pdb

Physical Information

Mass: 520946 Formula: C204H332N62O54S
Absent amino acids: CEPW Common amino acids: K
pI: 11.01 Basic residues: 12
Polar residues: 11 Hydrophobic residues: 10
Hydrophobicity: -105.26 Boman Index: -11128
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 64.21
Instability Index: 3451.58 Extinction Coefficient cystines: 5960
Absorbance 280nm: 161.08

Literature

  • PubMed ID:  1720095
  • Title:  Primary Structure of Frog Pituitary Adenylate Cyclase-Activating Polypeptide (PACAP) and Effects of Ovine PACAP on Frog Pituitary