General Information

  • ID:  hor001908
  • Uniprot ID:  P09686
  • Protein name:  Glicentin-related polypeptide
  • Gene name:  gcg
  • Organism:  Myoxocephalus scorpius (Shorthorn sculpin) (Cottus scorpius)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  Produced in the A cells of the islets of Langerhans in response to a drop in blood sugar concentration.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Myoxocephalus (genus), Cottidae (family), Cottales (infraorder), Cottioidei (suborder), Perciformes (order), Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0050896 response to stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  LQDAEDSSRFDADDTLAGEARELSTP
  • Length:  26(1-26)
  • Propeptide:  LQDAEDSSRFDADDTLAGEARELSTPKXHSEGTFSNDYSKYLETRRAQDFVQWLKNSXXXXXXXXHADGTFTSDVSSYLNDQAIKDFVAKLKSGKV
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level.
  • Mechanism:  X's in the sequence were included by homology with American goosefish sequences.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9D3P9-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-Q9D3P9-F1.pdbhor001908_AF2.pdbhor001908_ESM.pdb

Physical Information

Mass: 325601 Formula: C115H181N33O49
Absent amino acids: CHIKMNVWY Common amino acids: D
pI: 3.63 Basic residues: 2
Polar residues: 6 Hydrophobic residues: 8
Hydrophobicity: -95.77 Boman Index: -8883
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 60.38
Instability Index: 5199.23 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  3549298
  • Title:  Primary structures of three fragments of proglucagon from the pancreatic islets of the daddy Sculpin (Cottus scorpius).