General Information

  • ID:  hor001902
  • Uniprot ID:  P04092
  • Protein name:  Glicentin-related polypeptide
  • Gene name:  gcg2
  • Organism:  Lophius americanus (American angler) (Anglerfish)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  Produced in the A cells of the islets of Langerhans in response to a drop in blood sugar concentration.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lophius (genus), Lophiidae (family), Lophioidei (suborder), Lophiiformes (order), Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0050896 response to stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  MPDQDPDRNSMLLNENSMLTEPIEPLNM
  • Length:  28(22-49)
  • Propeptide:  MTSLHSLAGLLLLMIIQSSWQMPDQDPDRNSMLLNENSMLTEPIEPLNMKRHSEGTFSNDYSKYLETRRAQDFVQWLKNSKRNGLFRRHADGTYTSDVSSYLQDQAAKDFVSWLKAGRGRRE
  • Signal peptide:  MTSLHSLAGLLLLMIIQSSWQ
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P0C0P6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P0C0P6-F1.pdbhor001902_AF2.pdbhor001902_ESM.pdb

Physical Information

Mass: 372743 Formula: C134H218N36O49S4
Absent amino acids: ACFGHKVWY Common amino acids: LMNP
pI: 3.53 Basic residues: 1
Polar residues: 7 Hydrophobic residues: 5
Hydrophobicity: -87.14 Boman Index: -6898
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 69.64
Instability Index: 6422.86 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA